PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599075.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 612aa    MW: 68660 Da    PI: 4.4981
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599075.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-52291552128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     ppGfrFhPtdeelvv+yLk+k+ ++++ l ++i+e+d+yk++P+dLp  +k+k+++++w+fFs+rd+ky++g r+nratk+gyWkatgkd+ +++
  XP_009599075.1  29 PPGFRFHPTDEELVVYYLKRKICRRRILL-DAIAETDVYKWDPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARSNRATKHGYWKATGKDRIITC 122
                     9*************************999.99**************96559999***************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kktLvfykgrap ge+tdWvmhey++
  XP_009599075.1 123 -NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 155
                     .999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-6021178IPR003441NAC domain
PROSITE profilePS5100555.89428178IPR003441NAC domain
PfamPF023659.0E-2829154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MKLLVDSSTS SSSSACKEIR VFGESNVFPP GFRFHPTDEE LVVYYLKRKI CRRRILLDAI  60
AETDVYKWDP EDLPDLSKLK TGDRQWFFFS PRDRKYPNGA RSNRATKHGY WKATGKDRII  120
TCNSRAVGVK KTLVFYKGRA PVGERTDWVM HEYTMDEEEL KRCENAHDYY ALYKVFKKSG  180
PGPKNGEQYG APFKEEDWAD DECPVAEVSV QQQENSTKHV NEVPAAAADA LEELLKRIAD  240
DEPVLLEPFF VDNDYALDQL VQEEDTESTL LDQSSREVNL YNHCAVVGPS CQQYNVNASF  300
DLTQSGTSQL QLHEAAEVSS AHVNPEKPLH AVEEDFLEDF LEMDDLLGPE PSVQNFDDSA  360
LSIQNFDNQT PNGQIFDNPA GNLETVQFDG FDGLGEFDLY DAPLILDNEG TTVGQNGEPY  420
MNNFVNGIAY PDSTTYMSTF QNDIMNNRQM HLNHENQINH QLWRHDESFN VFNPIEGDQS  480
VVHQATSGVV YDNNTNHPMG ANQNPVAKKD DGAQSWISSN LWAFVDSIPT TPASAAESAL  540
VSRAFERMSS FSRMKLNARN INVAAGNTSA TSSSSGKFKN GFFCFSLLGV LCAVLWVLIG  600
ISDKIFGRYI SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-502818420174NAC domain-containing protein 19
3swm_B8e-502818420174NAC domain-containing protein 19
3swm_C8e-502818420174NAC domain-containing protein 19
3swm_D8e-502818420174NAC domain-containing protein 19
3swp_A8e-502818420174NAC domain-containing protein 19
3swp_B8e-502818420174NAC domain-containing protein 19
3swp_C8e-502818420174NAC domain-containing protein 19
3swp_D8e-502818420174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375250.0KF437525.1 Nicotiana benthamiana putative membrane bound NAC transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599075.10.0PREDICTED: NAC domain-containing protein 74-like
TrEMBLU5PZ850.0U5PZ85_NICBE; Putative membrane bound NAC transcription factor 2
STRINGSolyc04g072220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-113NAC domain containing protein 17